PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast02G262100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family TALE
Protein Properties Length: 345aa    MW: 36839.2 Da    PI: 5.1759
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast02G262100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox277.8e-092823172154
                         H..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  21 k..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            n+yps +e+ +LA ++gL+  q+++WF N R +
  Brast02G262100.1.p 282 HflNPYPSDNEKLRLAVSTGLSRGQISNWFINARVR 317
                         4449******************************88 PP

2BELL46.78.1e-16148211972
                BELL   9 kakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                         +akLl ll e++ r  +y e+l  v+ sFe + g  + + Ytsl ++a+ rhF +L+ ai  ++
  Brast02G262100.1.p 148 QAKLLGLLSELESREDHYFEELSRVALSFEPALGPAATAGYTSLMSRAMGRHFGNLRRAILRKL 211
                         58**********************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.6E-889209IPR006563POX domain
PfamPF075265.6E-1995207IPR006563POX domain
PROSITE profilePS5007111.612258321IPR001356Homeobox domain
SMARTSM003894.8E-9261325IPR001356Homeobox domain
CDDcd000869.30E-12262322No hitNo description
Gene3DG3DSA:1.10.10.602.6E-25266327IPR009057Homeodomain-like
SuperFamilySSF466893.46E-17267329IPR009057Homeodomain-like
PfamPF059206.0E-17278317IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MVATNLQGSS GSPKQQAPAA ADSANGTLPF QYPQEQRGGP CCHAPGHRGE DAAAGPLALT  60
LGGASAATGL DAACRCRRTR AADAPEMVVV VPSAVRGSRY LVPAQELLRD AVSMAEASAG  120
GGGGDSGDDD DEGGDETRVQ GATKGGLQAK LLGLLSELES REDHYFEELS RVALSFEPAL  180
GPAATAGYTS LMSRAMGRHF GNLRRAILRK LRLLHAARRP RVDDDGDGGE ESEEEVTEEM  240
VKRLVRRKKQ AAAARAAEQV CKPMRGLPED SVAVLRAWLF DHFLNPYPSD NEKLRLAVST  300
GLSRGQISNW FINARVRLWK PMIEEMYNDE FSEDSVSMDD ASSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrm_A6e-16267325563Homeobox protein Meis2
4xrm_B6e-16267325563Homeobox protein Meis2
5bng_A5e-16267325159Homeobox protein Meis2
5bng_B5e-16267325159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3733881e-101AK373388.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3029F10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003559582.11e-160PREDICTED: BEL1-like homeodomain protein 11 isoform X2
TrEMBLI1GPL21e-160I1GPL2_BRADI; Uncharacterized protein
STRINGBRADI1G12520.11e-159(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77153146
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75430.15e-35BEL1-like homeodomain 11